Published on

铁之女

star 777 slot online-🎖️judi slot menang besar|XOXE88.COM

judi slot menang besar

EksKuasahukumBharadaE,DeolipaYumara(kiri)memintauangfeeRp15triliunkepadaBareskrimPolri.Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-EkskuasahukumBharadaE,DeolipaYumaramengancambakalmenggugatPresidenJokoWidodo(Jokowi)hinggaKapolriJenderalListyoSigitPrabowojikapermintaannyatidakdikabulkan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Deolipamestar 777 slot onlinemintafeeRp15triliunkepadanegaraatasjasanyamenjadipengacaraBharadaE.AdapunDeolipaYumarasebelumnyaditunjukBareskrimPolriuntukmenjadipengacaraBharadaE.BacaJuga:JadiKuasaHukumBharadaE,RonnyTalapessyBilangBegini,TegasNamun,kiniDeolipasudahtakjadipengacaraBharadaE.AjudanIrjenFerdySamboitumencabutsuratkuasapenunjukanDeolipasebagaikuasahukum.Ya,kan,kita(saya)ditunjuknegara,negara,kan,kaya,masakitamintaRp15triliunenggakada.Yakalauenggakadakitagugat,catatsaja,kataDeolipakepadawartawan,Jumat(12/8).BacaJuga:BharadaETunjukKuasaHukumBaru,NihOrangnyaDeolipabakalmenggugatsecaraperdatakePengadilanTataUsahaNegara(PTUN)jikapermintaannyatersebuttakdikabulkannegara.Kapolrikita(saya)gugat,semuakitagugat.Presiden,menteri,kapolri,wakapolri,semuanyakitagugat,ujarpriaberambutgondrongitu.

TimnasU-16IndonesiasaatberlagadiPialaAFFU-162022.Foto:AseanFootball.jpnn.com,YOGYAKARTA-TimnasU-16IndonesiaberhasilmencuritigapoinsaatjumpaSingapurapadalanjutanGrupAPialaAFFU-162022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});BerlagadiStadionMaguwoharjo,Sleman,Rabu(3/8/2022),armadaBimaSaktimenangsembilangoltanpabalas.KemenanganiniturutberimbasterhadapVietnamyangdilagasebelumnyamenang5-0atasFilipina.Pasalnya,IndonesiaberhasilmenggusurtimberjulukTheGoldenStaritudaripuncakklasemenGrupA.BacaJuga:RibuanSuporterDukungTimnasU-16IndonesiavsSingapura,IniInfoTiketnyaTambahansembilangolmembuatIndonesiamemilikiproduktivitias+11,unggulduagoldariVietnam(+9).HasilinijugasangatpentingbagiArkhanKakadankawan-kawanuntukmenjagaasaloloskesemifinalPialaAFFU-162022.Sebab,hanyajuaragrupdantigarunnerupterbaikyangberhakloloskefaseberikutnya.BacaJuga:MabukdanMenabrakOrangHinggaTewas,BekPalmeirasLangsungDipecatDebutAnehKiperMudaAtleticoMadrid,DipaksaJadiStriker,KokBisa?NabilAsyuramenjadipemainpalingbersinardilagainidengantorehanhattrickpadamenit3,18,dan30.Selainitu,adaKafiaturRizkyyangmengemasbrace(35,43).Adapuntigagollainnyamasing-masingdibukukanolehHanifRamadhan(20),RiskyAfrisal(59),danIKomangAgus(90+1).(mcr15/jpnn)SuamiDewiPerssik,AnggaWijaya.ilustrasiFoto:FirdaJunita/JPNN.comjpnn.com,MAMPANG-SelebritasAnggaWijayadikabarkanjatuhmiskinsetelahberceraidariDewiPerssik.Mantanpegawaibankinitaklagitinggaldirumahmewah,melainkandikos-kosan.Akusekarangtinggaldikos-kosan,sendiridisana.Buatakupribadiitucukup,kataAnggaWijaya,dikawasanMampangPrapatan,JakartaSelatan.BacaJuga:IniAlasanAnggaWijayaPalsukanTandaTanganDewiPerssik,OalahDiapunmengakutetapbersyukurmeskikondisikehidupannyajauhberbedasaatmasihmenikah.Ngapainmewah-mewahan?Biayanya,kan,besar,tuturAnggaWijaya.PriayangtengahmerintiskarierdiduniahiburaninimengakuiikutmenikmatikemewahandariDewiPerssik.BacaJuga:DewiPerssikSiapkanMobilMewahuntukAnggaWijaya,Tetapi...Semuanyapunyadia,akuhanyaikutmenikmatifasilitasdiasaja,tetapienggakikutmemiliki,tuturnya.MenurutAngga,rumah,mobil,danfasilitasmewahlainnyaitusemuamiliksangmantan.star 777 slot online

star 777 slot online-🎖️judi slot menang besar|XOXE88.COM

MenteriLuarNegeri(Menlu)RIperiode2001-2004dan2004-2009NoerHassanWirajuda(kiri)saattampilmenjadipembicarawebinarbertajukkilasbalikKomnasHAMdantantangandalammendokumentasikankiprahKomnasHAMdiJakarta,Rabu(3/8).Foto:ANTARA/MuhammadZulfikarjpnn.com,JAKARTA-MantanMenteriLuarNegeri(Menlu)RINoerHassanWirajudamenilaiKomnasHAMmamputampilmenyampaikanfaktadankebenaranterkaitberbagaiperistiwapelanggaranHAM.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Sejakawal,KomnasHAMhadiruntukmemberikankebenaranalternatifagarkebenarantidakdimonopoliolehpenguasa,kataNoerHassanWirajudasaatmenjadipembicarawebinarbertajukkilasbalikKomnasHAMdantantangandalammendokumentasikankiprahKomnasHAMdiJakarta,Rabu(3/8).HassanmenegaskanKomnasHAMhadirdanlahiruntukmemberikankebenaranalternatif.BacaJuga:IrjenFerdySambodanPutriPastiDiperiksaKomnasHAM,Siap-SiapSajaHassanyangtercatatsebagaiMenluRIPeriode2021-2024dieraPresidenMegawasidanperiode2004-2009dieraPresidenSusiloBambangYudhoyono(SBY)merupakansalahseorangpemrakarsaberdirinyaKomnasHAMitumenyampaikanpermasalahanyangdihadapiolehgerakanHAMakanselaluada.Haltersebutterutamaterkaitsikapdanperilakuhumanwrong,yaituindividuyangmengabaikanetika,moral,hukum,danHAM.Olehsebabitu,menurutHassan,tantanganlembagaituakanselaluada.BacaJuga:Fakta-FaktayangDikantongiKomnasHAMIniMematahkanCelotehanKamaruddinSimanjuntakDiamengatakandiawalKomnasHAMdidirikan,paraanggotamampumembuktikanKomnasHAMsebagailembagayangkredibeldandiseganiolehpenguasa.Sementara,setelahreformasiKomnasHAMberadadalamsituasiyanglebihdemokratis,meskipunketidakpatuhanatasHAMmasihterusterjadi.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat)menghadirijumpapersdiMabesPolri,JakartaSelatan,Rabu(3/8)malam,gunamengumumkanstatusBharadaEsebagaitersangkapembunuhNofriansyahYosuaHutabarataliasBrigadirJ.Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-AjudanIrjenFerdySambo,BharadaE,tampaknyatakbisapulangkembalikekesatuannya,yakniMakoBrimob.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BareskrimlangsungmenahanBharadaEsetelahyangbersangkutanditetapkansebagaitersangkakasuspenembakanNofryansahYosuaHutabarataliasBrigadirJ.BharadaEadadiBareskrimdiPidum(pidanaumum)setelahditetapkantersangka.Tentuakandilanjutkandenganpemeriksaansebagaitersangkadanlangsungakankamitangkapdankamitahan,kataDirtipidumBareskrimPorliBrigjenAndiRianDjajadidiBareskrimPolri,Rabu(3/8).BacaJuga:BharadaEDijeratPasalIkutSertadanMembantuKejahatan,SiapaTersangkaLainnya?BharadaEditetapkansebagaitersangkasetelahpenyidikmelakukangelarperkarapadaRabumalam.PenyidikBareskrimPolrijugatelahmemeriksa42saksi.Diantaranya,sebelassaksidaripihakkeluargaBrigadirJdansejumlahsaksiahli.BacaJuga:PolisiGarap42SaksiSebelumTetapkanBharadaETersangkaPembunuhanBrigadirJTermasukdidalamnyaadalahahli-ahlibaikdariunsurbiologi,kimia,forensik,metalurgidanbalistikforensik,ITforensik,dankedokteranforensik,ujarAndi.Disisilain,penyidikjugatelahmelakukanpenyitaanterhadapsejumlahbarangbukti.LPSK.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-AnggotaPolriBharadaEyangsudahmenjalaniasesmenpsikologidiLembagaPerlindunganSaksidanKorban(LPSK)mengungkapadahalyangbakalmengancamnya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BharadaEmerupakananggotaBrimobyangterlibatpenembakanBrigadirYosuaaliasBrigadirJdirumahkadivPropamnonaktifPolriIrjenFerdySambo.WakilLembagaPerlindunganSaksidanKorban(LPSK)EdwinPartogiPasaribuberiketerangansoalBharadaE.Foto:FransiskusAdryantoPratama/JPNN.comBacaJuga:BharadaEstar 777 slot onlineDijeratPasalIkutSertadanMembantuKejahatan,SiapaTersangkaLainnya?KeteranganBharadaEtentangancamanitudiungkapkanWakilKetuaLPSKEdwinPartogidiJakarta,Rabu(3/8).MemangBharadaEmenyampaikansesuatuhalyangmenurutdiaakanmengancamnya,ungkapEdwin.Hanyasaja,EdwintidakbisamembukalebihdetailperihalancamanyangdimaksudolehajudanFerdySamboitu.BacaJuga:MisteriPakaian&PonselBrigadirJDijawabIrjenDedi,TernyatadiSiniBarangItuMohonmaafbelumbisakamisampaikankepadapublik,lanjutEdwin.TimLPSKsudahselesaimelaksanakanasesmenpsikologisterhadapBharadaE.IqlimaKimdiiming-imingiRp50jutaolehRazmanArifNasution.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-SelebgramIqlimaKimmengakudiiming-imingiuangRp50jutaolehRazmanArifNasution.Uangterebut,kataIqlima,sebagaipegantijikadirinyaberkenanmemutuskanhubungandengansangkekasih.Namun,tawaranitulangsungditolakmantanasistenpribadi(aspri)HotmanParisHutapea.BacaJuga:IqlimaKimMakinSeriusTerjunkeDuniaHiburan,IniBuktinyaInibukanmasalahduit,kalauenggaksuka,ya,enggaksuka,kataIqlimaKimdikawasanMenteng,JakartaPusat,Rabu(3/8).Jandasatuanakitumendugaiming-iminguangpuluhanjugaitumodusRazmanagarbisamempersuntingnya.Hampirsetiapsaat,(Razmanbilang)putuskansudah,ujarIqlimmenirukanperkataansangmantanpengacaranya.BacaJuga:HampirDiciumRazman,IqlimaKimBakalLaporPolisi?DiajugamengungkapkanbahwadirinyadidesakmembayarjasaRazmanapabilatidakmaumenjadiistrinya.Kamuharusjadiistrisaya.Kalautidak,yakamuharusbayarsaya,tuturIqlimaKim.PelajarSMPdiMeranginJambitewasditusukkakakkelasnya.SaatinikepolisianMeranginsedangmendalamimotifpenusukan.(ANTARA/HO/IST)jpnn.com,JAMBI-SeorangpelajarSMPdiLembahMasuraiKabupatenMerangin,Jambi,tewasditusuk,Rabu(3/8).KorbanberinisialIR(13)tewassetelahdidugamendapattikamandarikakakkelasnya,J(14).PelakusudahdititipkandiPolresMerangin.KarenamasihdibawahumurkamilakukanpenanganandiUnitPerlindunganPerempuandanAnak(PPA),kataKasatReskrimPolresMeranginAKPIndarWahyuDwiSetiawanketikadikonfirmasi.BacaJuga:SeusaiMembunuhAnggotaTNISersanKepalaHalil,SPulangBertemuAnakBerdasarkanketeranganyangdihimpunkepolisian,terdugapelakuitumerupakansiswapindahandariBengkulu.KetuaLembagaAdatDesasetempatYurani(65)mengatakankejadianituterjadidilingkungansekolah.Siswayangmeninggaltersebutdikenalsebagaianakyangbaik.BacaJuga:BrigjenTNISembiring:SayaAkanBertanggungJawabBilaAdaPrajurityangTerlibatNamun,diatakmengetahuipastibagaimanakronologihinggaterjadipenusukan.Yangkamitahuanaknyabaik,enggakneko-nekodanmuridyangpintar.Untukkejadianpersisnyabelumtahupastikarenadilingkungansekolah,terangnya.

IstriBaimWong,PaulaVerhoeven.Foto:YouTube/BaimPaulajpnn.com,JAKARTA-SelebritasPaulaVerhoevenmengakutakjubdengankawasanCitayamFashionWeekdiSudirman,JakartaPusat.Menurutnya,kawasanCitayamFashionWeekmemangbagusuntuktempatnongkrongdanberfoto.Banyaktempatfoto-fotobagus,Instagramble,tempatnongkrongnyajugaenak,kataPaulaVerhoevendalamvlogBaimPauladiYouTube,Rabu(3/8).BacaJuga:BaimWongDatangLagikeCitayamFashionWeek,LaluMinta...Dalamvlogtersebut,istriBaimWongitutampakkembalimendatangikawasanCitayamFashionWeek.PaulaVerhoevenmengakudatanglagiuntukbersantaidisorehari.Mainsaja,ucapnya.BacaJuga:IqlimaKimUngkapPeristiwadiDalamMobilBersamaRazmanArifNasution,AdaTangisanPaulaVerhoeventerlihatjalan-jalandikawasanCitayamFashionWeek.Ibu2anakitujugameladenipermintaanfotodariwargayangberadadisana.PetugasPolresSelumasaatmelakukanrekonstruksipembunuhananggotaTNIdiMapoldaBengkulu.ANTARA/AnggiMayasarijpnn.com,SELUMA-NyawaanggotaTNIKodim0425/SelumaSersanKepala(Serka)HalilPutramelayangditanganS.PembunuhanterjadidikebunsawitmilikSyangterletakdikawasanAmparGading,KelurahanLubukKebur,KecamatanSelumaKota,KabupatenSeluma,Bengkulu.TersangkaSmenjalani34adeganrekonstruksidiLapanganMapoldaBengkulu,Rabu.BacaJuga:BrigjenTNISembiring:SayaAkanBertanggungJawabBilaAdaPrajurityangTerlibatKasatReskrimPolresSelumaAKPDwiHandoyomengatakanrekonstruksidiawalidengantersangkapergikesalahsatupondokkecildikebunsawitmiliknya.Rekonstruksidilakukansebanyak34adeganyangdilakukandiMapoldaBengkulu,tetapitetapditanganiPolresSeluma,kataAKPDwiHandoyodiBengkulu,Rabu.Kemudianketikadipondokkecil,tersangkasempatmengasahduluparangyangdigunakannyauntukberkebundantidakberselanglamaSerkaHalilPutratibaditempatkejadianperkara(TKP).BacaJuga:PengacaraIstriFerdySamboNgototLaporkanBrigadirJAtasDugaanPencabulan,PengalihanIsu?Dalamrekonstruksitersebut,korbandantersangkasempatcekcokmulut,dankorbansempatmenantangtersangkauntukmelakukanpembacokan.Setelahkorbandibacok,tersangkakembalikepondokkebunnyauntukmengambilsepedamotordanpulangkerumah.IrjenFerdySamboditahandiMakoBrimob.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MantanKadivPropamIrjenFerdySambotelahdibawadariBareskrimPolridandiamankanditempatkhusus(patsus)KorpsBrimobmalamtadi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KepalaDivisiHumasPolriIrjenDediPrasetyomengatakanFerdySambodiamankanditempatkhususdalamrangkapemeriksaanterkaitpelanggarankodeetikpenanganantempatkejadianperkaratewasnyaBrigadirJ.(Penempatankhusus)dalamkontekspemeriksaan.Jadi,tidakbenaradaitu(penangkapandanpenahanan),ujarDedikepadawartawandiMabesPolri,Jakarta,Sabtumalam.BacaJuga:AKPRDitangkapPoldaKepri,IniKasusnyaDedijugamenyebutkan,belumadapenetapantersangkaterhadapFerdySambo,karenapemeriksaanterhadapmantanKepalaDivisiProfesidanPengamanan(KadivPropam)PolritersebutdilakukanoleholehInspektoratKhusus(Irsus)Polri,bukanTimKhusus(Timsus)Polri.IamenjelaskanadaduatimyangbekerjadalammengungkaptindakpidanaterkaittewasnyaBrigadirNofriansyahYosuaHutabaratatauBrigadirJ,yakniTimsussecaraprojustitiauntukpembuktiantidakpidana,danIrsusuntukpelanggaranetiknya.Jadi,Timsusinikerjanyaadalahprojustitia,tetapisesuaiarahanKapolri,selainTimsusadajugaInspektoratKhusus(Irsus),sepertiyangsudahdisampaikanKapolrikemarinmalambahwainspektoratkhusussudahmelakukanpemeriksaankepada25orang,katajenderalbintangduaitu.BacaJuga:IstriPergiArisan,RumahSepi,AyahTarikAnakKandungkeKamar,BeginiUjungCeritanyaDari25orangyangdiperiksatersebut,kataDedi,terdapatempatorangyangditempatkanditempatkhusus(Patsus)dalamrangkapembuktianyanglainnya,yaknisidangkodeetikkarenatidakprofesionaldidalammelaksanakanolahTKP.Hinggamalamini,lanjutDedi,hasilpemeriksaantimgabunganPengawasanPemeriksaanKhusus(Wasriksus)terhadapIrjenPol.FerdySamboyangdidugamelakukanpelanggaranprosedurdalampenanganantindakpidanameninggalnyaBrigadirJdirumahdinasKadivPropamPolri.

IstriSule,NathalieHolscherdikawasanMampangbeberapawaktulalu.ilustrasi.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-SidangceraiantaraNathalieHolscherdanSulemasihterusbergulirdiPengadilanAgama(PA)Cikarang.NathalieHolscherdanSulesendirisudahpernahmenjalanimediasi,tetapiberujunggagal.Sebab,keduanyasepakatuntukmengakhiribahterarumahtanggamereka.BacaJuga:AdaOrangKetigadiBalikPerceraianNathalieHolscherdanSule?Berikutfakta-faktabaruterkaitsidangceraiNathalieHolscherdanSule.1.SaksiSidangceraiNathalieHolscherdanSulekembalidigelardiPengadilanAgama(PA)Cikarang,Rabu(3/8).AgendasidangtersebutberupamenghadirkansaksidaripihakNathalieHolscherselakupenggugat,yakniadik,Nadia,danpengasuhAdzamAdriansyahSutisna.BacaJuga:SinggungSoalOrangKetiga,NathalieHolscher:KenapaBaruJujurSekarang?KuasahukumSule,Bahyunimenjelaskansoalpersidanganitu.Pihakpenggugattelahmenyampaikanbukti-buktitertulisdansudahdisampaikanolehpihaktergugattidakmenyangkalbukti-buktiolehpihakpenggugat,ujarBahyunidiPACikarang,Rabu.MantananggotaKompolnasEdiHasibuan.jpnn.com,JAKARTA-PengamananyangdilakukanPolriterhadapIrjenFerdySambodiMakoBrimobdianggapbelumseberapa.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PengamatkepolisianEdiHasibuanmeyakinikedepannyaakanadakejutanlainnyayangdilakukanPolriuntukmengusutkasuspembunuhanNofriansyahYosuaHutabarataliasBrigadirJ.SejakawalkamisampaikanbakaladakejutankejutanPolridalambeberapahariiniterhadapFerdySambo,kataEdidalamsiaranpers,Minggu(7/8).BacaJuga:IniAlasanPolriAmankanFerdySambodiPatsusKorpsBrimob,OhTernyataAnggotaKompolnasperiode20122016itumendukungtindakantegasKapolriJenderalListyoSigitPrabowoyangtelahmembawaFerdySambokeMakoBrimob.EdimengatakanPolriterusmendalamiketerlibataneksKadivPropamitudalamkasuspenembakanBrigadirJ.EdimenilaitindakantegasinitentuakanmembuatmasyarakatsemakinpercayabahwaPolrisangatseriusdantransparansertaterbukadalampenanganankasusini.BacaJuga:MahfudMDDapatInfosoalIrjenFerdySambo,SinggungIstilahCawe-CaweMenurutnya,kasusinicukuplamadiungkapkarenasejakawaladakendaladilapangan.Salahsatunyaadanyaupaya-upayapihaklainmenghilangkanbarangbuktidanmembersihksnlokasikejadiansaatperisiwainiterjadidirumahdinasIrjenFerdySambo.HotmanParis,RichardLee,danKienzyMyliendikawasanKelapaGading,JakartaUtara.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisakhirnyaberdamaidenganRichardLeedanselebritasInstagram(selebgram)KienzyMylien.HalituberawalketikaKienzymenyebutHotmanParissaatlivediInstagram.DiamengatakanogahdibungkusolehHotmanParis.Sebab,diamenilaipengacaratersebutmemilikibanyakwanita.BacaJuga:AtasiInfeksiJamurDaerahKewanitaandengan8PengobatanAlamiIniPernyataanitudiasampaikansambilmenggunakanprodukRichardLee.Berikutmomen-momenperdamaianantaraHotmanParisdenganKienzyMylien.1.KlarifikasiBacaJuga:5PernyataanHotmanParisSoalDugaanPelecehanSeksualyangDilakukanRazmanNasution,CekNomor4DokterkecantikanRichardLeeternyataterkejutketikaHotmanParismensomasidirinyadanselebritasInstagram(selebgram),KienzyMylien.Diapunlangsungmemintatimnyauntukmencaritahuakarpermasalahantersebut.RizkyBillardanLestiKejora,saatjumpapersakuisisiLeslarEntertaimentolehPrestigeCorpdanpeluncuranLeslarMetaverse,diPenjaringan,JakartaUtara,Jumat(11/3).Foto:Romaida/JPNN.comjpnn.com,JAKARTA-AktorRizkyBillarmemberikansebuahkadoistimewadiulangtahunistrinya,LestiKejorapadaJumat(5/8).Tidaktanggung-tanggung,priaasalMedan,SumateraUtaraitumemberikansebuahmobilmewahasalInggris,yakniRollsRoyce.HalituterungkapmelaluiunggahanfotodiakunpribadinyadiInstagram.BacaJuga:RizkyBillarUngkapAlasanJarangMainSinetronAkhir-akhirIniDalamfototersebut,ayahanaksatuitumemperlihatkanmobilmewahyangmemilikihargamiliarrupiahitu.Mobilberkelirhitamitudiberikanpitadanbalonmerahberwarnapink.RizkyBillarmemberikahadiahmobilmewahuntukistrinya,LestyKejora.Foto:Instagram/RizkybillarBacaJuga:DituduhMenumpangHidupdenganLestiKejora,RizkyBillarJawabBegini,TegasRizkyBillarituberposesambilmemeluksangistri,LestiKejora.Alhamdulillah,senangrasanyasebagaisuamibisamewujudkansatupersatuimpianistri,tulisAktor26tahunitusebagaiketeranganfoto,dikutip(Minggu(7/8).

BhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-DeolipaYumaramenjadikuasahukumbaruBhayangkaraDuaRichardEliezeratauBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DiamenggantikanAndreasNahotSilitongayangmengundurkandiripadaSabtu(6/8)kemarin.DeolipamengatakandiasudahberkomunikasidenganBharadaEterkaitperkembangankasuskematianBrigadirJatauNofriansyahYosuaHutabarat.BacaJuga:KeterlibatanIrjenFerdySamboTerungkap,BareskrimMintaBantuanBrimob,TegangDarihasilkomunikasiitu,BharadaEsepakatmengajukanjusticecollaborator.Kamibersepakat,ya,sudahkamiajukanyangbersangkutan(BharadaE,red)sebagaijusticecollaboratordankamimemintaperlindunganhukumkeLPSK,kataDeolipadiBareskrimPolri,Sabtumalam.DeolipamenyebutkliennyayangmerupakananggotaBrimobitusebagaisaksikuncidalamkasuskematianBrigadirJ.BacaJuga:PengacaraBharadaEMengundurkanDiri,IPW:IndikasiKasusBrigadirJDirekayasaMakinKuatHalitu,katadia,setelahdirinyadanBurhanuddinbertemusecaralangsungdenganBharadaEdanmendengarkansemuaceritaperihalkasuskematianBrigadirJ.Tentunyakamidalamkacamatakontekshukuminipentinguntukdilindungisebagaisaksikuncimeskipuntersangka,tuturDeolipa.IrjenFerdySambobersamaPutriCandrawathi.DokInstagram@divpropamporli.jpnn.com,DEPOK-PutriCandrawathigagalbertemudengansuaminya,IrjenFerdySamboyangditahandiMakoBrimob,KelapaDua,Depok,Minggu(7/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Putriyangdatangbersamaanakdantimpengacaranyaitukemudianmemberikanketerangankepadaawakmediayangadadilokasi.AnggotaBhayangkariitumengakuikhlasdengansegalaperbuatanyangterjadidanapayangdialamikeluarganyasaatini.BacaJuga:IrjenFerdySamboDibawakeMakoBrimob,BikinSulitPenyelidikanKomnasHAM?Sayaikhlasmemaafkansegalaperbuatanyangkamidankeluargaalami,kataPutridiareaMakoBrimob,Depok,Minggu.Selainberbicarakeikhlasan,wanitayangpernahtinggaldiMakassar,SulawesiSelatantersebutjugaberbicaraketulusansehinggadatangkeMakoBrimobuntukmenemuiIrjenFerdySambo.Sayamemercayaidantulusmencintaisuamisaya,ungkapPutri.BacaJuga:KeteranganTerbaruBharadaE,SinggungSoalPistoldanIrjenFerdySambo?Sementaraitu,pengacaraPutri,ArmanHanismengakudatangkeMakoBrimobbersamakliennyademimenjengukdanmemberikanbajuuntukIrjenFerdySambo.Namun,kataArman,pihakMakoBrimobbelummemberikanizinbagirombonganuntukmenemuimantanKadivPropamPolriitu.

star 777 slot online-🎖️judi slot menang besar|XOXE88.COM

PutriCandrawathi,istriIrjenFerdySambomenangissaatmenyampaikanpermintaanmaafdandukungankepadamasyarakatataskasusyangmenimpakeluarganya.Foto:SC/Antaravideo/AzhfarMuhammadRobbani/NabilaAnisyaCharisty/SatrioGiriMarwanto/RintoANavisjpnn.com,JAKARTA-PutriCandrawathi,istrimantanKadivPropamIrjenFerdySambo,mendatangiMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8/2022)sore.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KedatanganPutriCandrawathiuntukmenjenguksuaminyayangditahanuntukmenjalanipemeriksaanterkaitdugaanpelanggaranetikkasuskematianBrigadirJdirumahdinaspribadinya.Namun,wanitayangpernahtinggaldiMakassar,SulawesiSelatanitugagalbertemuFerdySambo.BacaJuga:IniAlasanPolriAmankanFerdySambodiPatsusKorpsBrimob,OhTernyataPutripunsempatmemberikanketerangankepadaawakmediayangadadilokasi.Putrimenangissaatmenyampaikanpermintaanmaafdandukungankepadamasyarakatataskasusyangmenimpakeluarganya.AnggotaBhayangkariitumemercayaiseutuhnyaFerdySambodanberbicaratentangcintayangtuluskepadaeksKadivPropamPolriitu.BacaJuga:Ada2JenderaldiSampingJohanChristySaatMenerimaKenaikanPangkatLuarBiasa,SiapaDia?Sayamemercayaidantulusmencintaisuamisaya,kataanakdariseorangpurnawirawanjenderalTNIitudiareaMakoBrimob,Depok,JawaBarat,Minggu.Diapunmemohonkepadapublikbisamendoakanseluruhkeluarganyaagarkuatmenghadapimasasulittersebut.HENtersangkapenganiayaanyangberujungkeatiansangistriKampar.Foto:HumasPolresKampar.jpnn.com,KAMPAR-PolisimenangkapHEN(44)wargaPerumahanManunggalJaya,DesaRimboPanjang,KecamatanTambang,KabupatenKampar,RiauataspenganiayaanyangmenewaskansangistriNelliElfida(49).NellimeninggalduniasetelahmendatangirumahKetuaRTYasriYantountukmengadukanperbuatansangsuami,Sabtu(6/8).Siangitusekitarpukul14.10WIB,korbantiba-tibadatangkerumahRTsetempat,kataKapolsekTambangIptuMardaniTohenes,Minggu(7/8).BacaJuga:DiancamAkanDihabisi,ARTBakalBertanyaLangsungkepadaKapolriDiamenjelaskansaatituNellidatangdengankondisimukapucat,badanmenggigilsembarimintatolongkepadaYasri.KorbandatangkerumahPakRT,mengakudipukuliolehsuaminya,lanjutMardani.Setelahitu,Nellitelungkupkelantaidiruangtamu,sedangkanPakRTlangsungmencariHENdirumahnya,tetapipelakutidakada.BacaJuga:SetelahGagalBertemuIrjenFerdySambo,PutriCandrawathi:SayaIkhlasSaatPakRTkembalikerumahnya,Nellimasihterlihattidurdenganposisimenelungkup.Kemudian,YasribersamamertuaperempuannyamencobamembangunkanNelli.PengamathukumpidanadariUniversitasTrisaktiAbdulFickarHadjarmembahastempatkhusus(patsus)IrjenFerdySambodiMakoBrimob,Depok.Foto:dokumenJPNN.comjpnn.com,DEPOK-IrjenFerdySambodibawakeMarkasKomando(Mako)KorpsBrimob,KotaDepok,JawaBarat,padaSabtu(7/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});IrjenFerdySamboditempatkanditempatkhususdalamrangkapemeriksaanpelanggaranprosedurpenanganankasuskematianBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.Lantas,sepertiapatempatkhususyangmenjadilokasipemeriksaanterhadapIrjenFerdySambo?BacaJuga:BahasKemungkinanFerdySamboDiperiksadiMakoBrimob,KomnasHAMBilangBeginiBilamerujukpadaPeraturanKapolriNomor2Tahun2016tentangPenyelesaianPelanggaranDisiplinAnggotaPolriPasal1Angka35tertulisbahwatempatkhususyangselanjutnyadisingkatpatsusadalahmarkas,rumahkediaman,ruangtertentu,kapal,atautempatyangditunjukolehAnkum.PakarhukumpidanadariUniversitasTrisaktiAbdulFickarHadjarmengatakanpatsusIrjenFerdySambodiMakoBrimobsudahtepat.IrjenFerdySambo,lanjutAbdul,yangmerupakansalahsatuPerwiraTinggiPolriharusditempatkanditempatyangdijagaketat.BacaJuga:IrjenFerdySamboDibawakeMakoBrimob,BikinSulitPenyelidikanKomnasHAM?Harusditempatyangpenjagaannyalebihketat,kataAbdulkepadaJPNN.com,Minggu(7/8).TidakmustahilbisaterjaditerjadijugaadapengerahanpasukanyangmerupakansimpatisanFS,kataAbdul.BhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNNjpnn.com,JAKARTA-PengacaraRichardEliezeratauBharadaE,DeolipaYumaramenyebutkliennyatidakpunyamotifmembunuhNofriansyahYosuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Betul,yangbersangkutantidakpunyamotif,kataDeolipasaatdihubungi,Minggu(7/8).Menurutdia,temuanBharadaEtidakpunyamotiftentunyabisamenjadipetunjukbagikepolisianmengungkapkasustewasnyaBrigadirJ.BacaJuga:Ternyata,BeginiTempatKhususFerdySambodiMakoBrimob,MengapadiSana?Misalnya,anggotatimkhusus(Timus)bisamengungkaptokohutamadalamkasustewasnyaanggotaBrimobitudalamperistiwaberdarahdirumahdinasIrjenFerdySambo,JakartaSelatan,Jumat(8/7).Betul,artinyadisiniadaperintah,ujarnya.DeolipasebagaipengacaraBharadaEmengakusudahmengantonginamatokohutamadalamkasustewasnyaBrigadirJ.BacaJuga:IrjenFerdySamboDibawakeMakoBrimob,BikinSulitPenyelidikanKomnasHAM?Namun,diabelumbisamengungkapkepubliksosokutamadalamperkaratewasnyaajudanIrjenFerdySamboitu.Sebab,masukwilayahpenyelidikan,ujardia.

PutriCandrawathi(kanan)diMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,DEPOK-IstriIrjenFerdySambo,PutriCandrawathitakkuasamenahantangissaatmemberikanketerangankepadamedia,didepanMarkasBrigadeMobilKepolisianNegaraRepublikIndonesia,KelapaDua,KotaDepok,JawaBarat,Minggu(7/8)malam.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BuPutribersamasalahsatuanaknyadandidampingiArmanHanis(kuasahukumBuPutridanPakFerdy)datangkeMarkasBrimobdenganmaksudhatimenjengukFerdySambo.Namun,keinginanPutriCandrawathimelihatFerdytakkesampaian.BacaJuga:PutriCandrawathi DatangkeMakoBrimob,BicaraCintaTuluskepadaIrjenFerdySamboSebelumberanjakdariKelapaDua,BuPutritampakberusahamenguatkandiriberbicaradidepankameraparapemburuberita.SayaPutri,bersamaanak-anak,sayamemercayaidantulusmencintaisuamisaya,katanya.WajahPutritertutupmaskerputih,tetapiterlihatmatanyasembapdanairmataturunmembasahipipi.BacaJuga:AdayangAnehdariFotoPakFerdySambodanParfumBuPutriCandrawathi?BuPutrimenangis.Sayamohondoaagarkamisekeluargadapatmenjalanimasayangsulitini,dansayaikhlasmemaafkansegalaperbuatanyangkamidankeluarga(meng)alami,tuturPutri.LunaMayadanMaiaEstianty.Foto:YouTube/LunaMayajpnn.com,JAKARTA-AktrisLunaMayakagetsaatmengetahuihargatopimilikpenyanyiMaiaEstianty.Diatidakmenyangkatopidihiasibungatersebutbisamencapaihargapuluhanjutarupiah.HaltersebutdiketahuisaatLunaMayamenggerebekisilemariMaiaEstiantyyangditayangkandalamvlogmiliknya.BacaJuga:ManajerDitangkapPolisi,BCLTetapMenggelarKonserdiSingapuraRp30juta,guys,kataLunaMayasambilberteriakhisteris,Minggu(7/8).MantanpacarArielNOAHituherantopimilikMaiaEstiantyitubisamencapaihargaRp30juta.Sebab,menurutLunaMaya,bentuktopianyamanitusangatsederhana.BacaJuga:RizkyBillarUngkapAlasanJarangMainSinetronAkhir-akhirIniDiinjaklangsung(rusak),kelakarLunaMaya.MaiaEstiantymengatakanbahwatopitersebutdipakainyasaatmenghadiriundanganRatuInggris.KapolresSukabumiAKBPDedyDharmawansyahsaatmenunjukkanbarangbuktimilikkorbanyangdisitadaritangantersangkakasuspencuriandengankekerasanberinisialVSyangmenyebabkankorbannyameninggaldunia.Antara/AdityaRohmanjpnn.com,KABUPATENSUKABUMI-PembunuhanterhadappengendaraojekbernamaSalmanwargaKampungLegokloa,KabupatenSukabumi,JawaBaratpada23Juli2022akhirnyaterkuak.PolisimenangkappelakupembunuhanberinisialVS.Motiftersangkanekatmenghabisinyawakorbannyakarenainginmenguasaihartanya,yaknisepedamotordanuanghasilmenggadaikankendaraandigunakanuntukberfoya-foya,kataKapolresSukabumiAKBPDedyDharmawansyah,Minggu(7/8).BacaJuga:IrjenFerdySamboMalam-MalamDibawakeTempatKhususMenurutDedy,meskipunVSberperawakankurusdanpendek,tetapi,tersangkadikenalsadisdalammelakukanaksinya.Sebelummelakukanpembunuhanterhadappengojek,VSjugapernahmendekamdipenjarakarenaterlibatkasuspencuriandengankekerasan.Tersangkasempatmelakukantindakankekerasanterhadapseorangibu-ibudiKecamatanSimpenankarenainginmengambilkalungemasmilikkorban.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanSetelahbeberapatahunkeluardaripenjaradanmenyandangstatusresidivis,yangbersangkutanbukannyatobatmalahsemakinmenjadi.Sebelumnya,kejadianpembunuhanyangdilakukannya,VSjugadilaporkantelahmelakukanpenggelapandanpenipuan,tidakberselanglamatersangkakembaliterlibatkasusyanglebihberatlagiyaknimelakukanpembunuhanterhadappenarikojekdengantujuaninginmenguasaihartanyayaknisepedamotornya.IrjenFerdySamboseusaimenjalanipemeriksaandigedungBareskrimPolri,Jakarta,Kamis(4/8).Foto:Ricardojpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangMinggu(7/8)tentangBharadaEsudahbicaradarihatikehatidenganDeolipaYumara,campurtanganIrjenFerdySamboterungkap,setelahdiamankanmasihadakejutanlaindarikasusBrigadirJ.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.KeterlibatanIrjenFerdySamboTerungkap,BareskrimMintaBantuanBrimob,TegangBacaJuga:5BeritaTerpopuler:IrjenFadilImranBicaradenganPresiden,PasukanBrimobBergerak,AdaTumbalpadaKasusBrigadirJ?IrjenFerdySambopadaSabtu(6/8)soredibawakeMarkasKorpsBrimobuntukditempatkanditempatkhususdalamrangkapemeriksaanpelanggaranprosedurpenanganankasuskematianBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.KepalaDivisiHumasPolriIrjenDediPrasetyomenjelaskan,IrjenFerdySambolangsungdibawadariBareskrimPolrikeMakoBrimobsesuaimenjalanipemeriksaanolehInspektoratKhusus(Irsus).DedimenjelaskandalampenanganankasuskematianBrigadirJadaduatimyangbekerja.BacaJuga:5BeritaTerpopuler:MunculFaktaTerbaruBakuTembakdiRumahFerdySambo,4PerwiraDitahan,TernyataBacaselengkapnya,kliklinkdibawah:KeterlibatanIrjenFerdySamboTerungkap,BareskrimMintaBantuanBrimob,Tegang

MantanKadivPropamPolriIrjenFerdySambobeberapawaktulalumendatangiGedungKabareskrimMabesPolrimenggunakanmobilberkelirhitam.IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-MantanKadivPropamPolriIrjenFerdySambobeberapawaktulalumendatangiGedungKabareskrimMabesPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601110242209-0);});KehadiranIrjenFerdySambountukmenjalanipemeriksaankasuskematianBrigadirNofryansahYouaaliasBrigadirJdirumahdinasnyayangberlokasidiKomplekPolriDurenTiga,JakartaSelatan.JenderalbintangduaitudatangkemarkasyangdipimpinolehKomjenAgusAdriantodenganmenunggangimobilandalannya,yaituToyotaKijangInnova.BacaJuga:SetelahGagalBertemuIrjenFerdySambo,PutriCandrawathi:SayaIkhlasMobilberkelirhitamituyangdigunakanIrjenFerdySambotersebutmerupakangenerasiterbaruyangdirilispada2015lalu.MobilitumemilikidesaineksteriormodernkarenaterdapatlampuutamaLED.ToyotaInnovarebornmemilikikonfigurasitujuhpenumpangdenganpilihanjokcaptainseatdibariskedua.BacaJuga:IrjenFerdySamboDibawakeMakoBrimob,BikinSulitPenyelidikanKomnasHAM?Mobiltersebutditawarkandalamduapilihanmesindieseldanbensin.Untukmesindieselmemilikikapasitas2.400ccdengantenaga149PSdantorsi400Nm.PenyidikTimsusBareskrimPolrimenetapkanajudanistriFerdySambo,BrigadirRickyRizalatauBrigadirRRditetapkansebagaitersangkapembunuhanberencana.Ilustrasi.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-BrigadirRickyRizalatauBrigadirRRditetapkansebagaitersangkadanlangsungditahandiRutanBareskrimPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirRRmerupakanajudanPutriCandrawathi,istriIrjenFerdySambo.BrigadirRRdijeratPasal340KUHPtentangpembunuhanberencanaterhadapkasuskematianBrigadirNofriansyahYosuaHutabaratatauBrigadirJdirumahdinasIrjenFerdySambo.BacaJuga:Terungkap,BharadaETernyataTidakPunyaMotifUntukMembunuhBrigadirJ(RRdisangkakan)denganPasal340subsiderPasal338junctoPasal55danPasal56KUHP,kataKetuaTimPenyidikTimsusBareskrimPolriBrigjenAndiRianDjajadisepertidilansirAntara,Minggu(7/8).DirekturTindakPidanaUmumBareskrimPolriitupenahananterhadapBrigadirRRterhitungmulaiMinggu(7/8)kemarin.Sebelumnya,TimPenyidikTimsusBareskrimPolritelahmenetapkanBhayangkaraDuaRichardEliezirPudihangLumiuatauBharadaEsebagaitersangkadengansangkaanPasal338KUHPjunctoPasal55danPasal56KUHP.BacaJuga:BharadaEDitahandiBareskrim,IrjenFerdySambodiMakoBrimob PasaliniberbedadenganyangdisangkakankepadaBrigadirRR.KeduanyaditetapkansebagaitersangkaberdasarkanlaporanpolisiyangdilayangkankeluargaBrigadirJ,yakniterkaitdugaanpembunuhanberencanaPasal340KUHPjuncto338,juncto351ayat(3)juncto55dan56KUHP.

star 777 slot online-🎖️judi slot menang besar|XOXE88.COM

BillySyahputramemelukElviaCerollinedidepanIrmaDarmawangsa.Foto:YouTube/BillySyahputrajpnn.com,JAKARTA-PresenterBillySyahputraketahuanmemelukmesramantankekasihnya,ElviaCerolline.KeduanyatepergokdiruanggantiolehpenyanyidangdutIrmaDarmawangsa.Gueheran,sudahmantanmasihpeluk-peluk,cium-cium,kataIrmaDarmawangsadengannadasewotdalamvlogmilikBillySyahputradiYouTube,Senin(8/8).BacaJuga:IniAlasanAnggaWijayaDiam-diamMenaikkanTarifDewiPerssik,TernyataMendengarucapanIrmaDarmawangsa,BillySyahputralantasmemberipenjelasan.DiamengakumemelukElviaCerollinesebagaitandahubunganmerekamasihbaik-baiksajameskiputuscinta.Cumapelukbiasa,kalaugue,kan,tetapbaik,ujarBillySyahputra.BacaJuga:LunaMayaKagetSaatTahuHargaTopiMaiaEstianty,WowBangetAdikmendiangOlgaSyahputraitupernahmenjalinhubunganasmaradenganElviaCerolline.Akantetapi,hubunganBillySyahputradanperempuanyangkaribdisapaElituhanyabertahansetahunlamanya.KepulanganjamaahhajiKloter32EmbarkasiSurabaya(SUB32)diwarnaibadaipasirdiBandaraMadinah,Minggu(7/8).Foto:ANTARA/HO.MCH2022jpnn.com,MADINAH-JemaahhajiasalIndonesiaditerjangbadaipasirdiBandaraInternasionalPangeranMuhammadbinAbdulAziz,Madinah,ArabSaudi,Minggu(7/8).BelakangancuacaekstremterjadidiArabSaudi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Namun,KepalaDaerahKerjaBandaraHaryantomenyatakanjemaahtetapamandansehat.Alhamdulillahamansemua.InformasiuntukJKS36yangmenujubandaradarihotelMadinah,seluruhnyaberhenti,ujarnyadiMadinah,Minggu.BacaJuga:69.944JemaahHajiSudahTibadiIndonesia,YangMeninggalBertambahLagiHaryantomemastikanseluruhjemaahdanpetugasaman.Diajugamenyampaikanrombonganjemaahyangtengahmenujubandaradarihotelberhentiterlebihdahulu.Haryantosempatmerasakanbadaipasirketikaberadadijalan.Haryantomengatakanlangitgelap,tetapihanyasebentardanmereda.Semogalebihbaikcuacanya.Dijalancuacagelap,tetapiinisebentarsajasudahselesai,ujarHaryanto.BacaJuga:KabarBaikdariArabSaudiuntukJemaahUmrahIndonesia,BanyakKemudahannya Badaimelandasekirahabisasarwaktusetempatdanberlangsunghanyasebentar.Akibatbadaitersebut,penurunanjemaahasalkelompokterbang(kloter)SurabayayangtergabungdalamSUB32daribusmenujukeplazaterminalhajisempattertahan.

IrjenFerdySambosaattibadigedungBareskrimPolri,Jakarta,Kamis(4/8),untukmenjalanipemeriksaanterkaitkasuskematianBrigadirJ.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-BharadaRichardEliezerPudihangLumiuatauBharadaEsudahbeberapakkalimenjalanipemeriksaansebagaitersangkakasustewasnyaBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BharadaEmenyampaikansejumlahpoinpengakuanatauketeranganbarudihadapanpenyidikTimsusPolri.AntaralainsoalmotifpembunuhanterhadapBrigadirJ,anggotaBrimobyangmenjadiajudanistriFerdySambo,PutriCandrawathi.BacaJuga:BrigadirRickyRizalDitahan,IstriFerdySamboUngkapCintaTulusdiPinggirJalanPengacaraRichardEliezeratauBharadaE,DeolipaYumaramenyebutkliennyatidakpunyamotifmembunuhNofriansyahYosuaHutabaratatauBrigadirJ.Betul,yangbersangkutantidakpunyamotif,kataDeolipasaatdihubungi,Minggu(7/8).PengakuanBharadaEbahwadirinyatidakpunyamotif,kataDeolipa,tentunyabisamenjadipetunjukbagikepolisianmengungkapkasustewasnyaBrigadirJ.BacaJuga:RahasiaTangisanBuPutriCandrawathidiMakoBrimob,JanganDitahanBharadaEMengakuMendapatPerintahdariAtasanDeolipaYumarajugamengatakanBharadaEjugamengakumendapatperintahdariatasanuntukmembunuh.Dia(mengaku,red)diperintaholehatasannya.Ya,perintahnya,ya,untukmelakukantindakpidanapembunuhan,ucapDeolipamelaluilayananpesan,Minggu(7/8).GandaputraMalaysiaAaronChia/SohWooiYikgagalnaikpodiumtertinggiCommonwealthGames2022.Foto:Twitter/@Badminton_Asiajpnn.com,BIRMINGHAM-KutukanbagigandaputraMalaysia,AaronChia/SohWooiYikterusberlanjut.Keduanyakembaligagalnaikpodiumtertinggi,kaliinidiajangCommonwealthGames2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Aaron/Sohsecaramengejutkankeokdisemifinaldaripasangantuanrumah,BenLane/SeanVendy(Inggris).WakilNegeriJiranitutumbanglewatpertarunganrubbergamedenganskor21-18,17-21,4-21diNationalExhibitionCentre,Birmingham.BacaJuga:KlasemenLigaInggrisSetelahMUKeokdanManCityBerjayaHasiliniterbilangmengejutkankarenasecaraperingkatAaron/SohberadajauhdiatasBen/Sean.WakilMalaysiaitusaatiniberadadirankingenamdunia,sedangkanBen/Seanmasihtercecerdiposisike-19.Takcumaitu,Aaron/SohjugamenyandangunggulanpertamaCommonwealthGames2022.BacaJuga:EriktenHagPujiCristianoRonaldo,TetapiSebutAda1KekuranganKekelahaninimenambahpanjangcatatankelambagiAaron/Soh.Hinggasaatini,keduanyabelumsekalipunnaikpodiumtertinggidalamturnameninternasional.Beruntung,Aaron/SohbisasedikitterhiburkarenaberhasilmerebutmedaliperungguCommonwealthGames2022.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat)mengomentarisoalstatusBrigadirRickysebagaitersangkapembunuhNofriansyahYosuaHutabarataliasBrigadirJ.Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-BrigadirRickyRizalatauBrigadirRR,ajudanPutriCandrawathi,istriIrjenFerdySamboditetapkansebagaitersangkadanlangsungditahandiRutanBareskrimPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirRRdijeratPasal340KUHPtentangPembunuhanBerencanaterhadapkasuskematianBrigadirNofriansyahYosuaHutabaratatauBrigadirJdirumahdinasIrjenFerdySambo.(RRdisangkakan)denganPasal340subsiderPasal338junctoPasal55danPasal56KUHP,kataKetuaTimPenyidikTimsusBareskrimPolriBrigjenAndiRianDjajadisepertidilansirAntara,Minggu(7/8).BacaJuga:JenderalBintang2IniSebutFerdySamboDijagaKetat,Selama30HarikeDepan,PerintahSiapa?DirekturTindakPidanaUmumBareskrimPolriitupenahananterhadapBrigadirRRterhitungmulaiMinggu(7/8)kemarin.Sebelumnya,TimPenyidikTimsusBareskrimPolritelahmenetapkanBhayangkaraDuaRichardEliezirPudihangLumiuatauBharadaEsebagaitersangkadengansangkaanPasal338KUHPjunctoPasal55danPasal56KUHP.PasaliniberbedadenganyangdisangkakankepadaBrigadirRR.BacaJuga:IniAlasanPolriAmankanFerdySambodiPatsusKorpsBrimob,OhTernyataKeduanyaditetapkansebagaitersangkaberdasarkanlaporanpolisiyangdilayangkankeluargaBrigadirJ,yakniterkaitdugaanpembunuhanberencanaPasal340KUHPjuncto338,juncto351ayat(3)juncto55dan56KUHP.AdapunpenerapanPasal55danPasal56terhadaptersangkaBhadaraEdanBrigadirRRdimungkinkanmasihadatersangkalainnyayangdidugaterlibatdalamkasusini.Ilustrasi-PasangansuamiistriFoto:Ricardo/JPNN.comjpnn.com-SeksologdrBoykeDianNugrahaSpOGmengakubanyakdidatangipasienpriaberusia30tahun,yangmengeluhsudahejakulasidini.Parapasientersebutmengakubingungkarenaalatvitalmerekasulitberdiridancepatmengeluarkancairan,padahalmasihmuda.AlumnusFakultasKedokteranUniversitasIndonesia(FKUI)inimengatakanejakulasidinidisebabkanmakananyangkerapdikonsumsi.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaMenurutdokterBoyke,banyakmengonsumsimakananinstanjugabisamenjadisalahsatupenyebabnya.Selainitu,Boykemenyarankanagarmerekamenerapkanpolahidupsehatdanmelatihcarabercinta.Kalaucowokyangsudahmatangdiabisamengaturkapanejakulasi.Durasinya,gerakannya,diabisaatur,tuturBoyke,dikanalWAWEntertainment.BacaJuga:Jerinx:Benar,SayaSempatDepresi,MerasaGagaljadiSuamiKeutamaanPuasaAsyuraBersertaNiatnyaPriakelahiran14Desember1956inijugamengungkapkancaraagarbisamencapaiklimaksbercinta.Jadi,ketikamauberhubungananggapitumain-main,ituadalahkehidupanyangmenyenangkan.Pokoknyanikmatiprosesnya,ungkpdrBoyke.(chi/jpnn)PolisiberjagadirumahdinasIrjenFerdySambo,KompleksPolriDurenTigasaatprarekonstruksikasusbakutembakpolisiyangmenewaskanBrigadirJ,Jakarta,Sabtu(23/7/2022).Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-KolumniskondangDahlanIskantidakcumamenyorotipelanggaranetikmantanKadivPropamPolriIrjenFerdySambodikasuspembunuhanYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MelaluitulisanberjudulMendungUdandikolomDisway,DahlanjugamengulasdramabarukasuspembunuhanBrigadirJ.MenurutDahlan,setelahIrjenSamboditahan,masihbanyakdramabaruyangakanterungkap,salahsatunyatelahdimulaiolehBharadaE,tersangkapembunuhanYosua.BacaJuga:DahlanIskanMeneleponMahfudMD,BeginikahNasibIrjenFerdySambo?HmmmBharadaEyangselamainidisebutmenembakBrigadirJsudahmenyangkalitu,demikiandikutipdariDiswayedisiSenin(8/8).TulisaninibertepatandengansebulantewasnyaBrigadirJdirumahdinasFerdySambo,kawasanDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.MenurutDahlandalamtulisanitu,BharadaEsudahmulaitidaksungkanuntuktidakmenjalankanskenariosutradara.BacaJuga:DiancamAkanDihabisi,ARTBakalBertanyaLangsungkepadaKapolriDIapunmempertanyakanapakahistriIrjenFerdySambo,PutriCandrawathiakankonsistendenganskenariodilecehkansecaraseksual.Kelihatannyaskenariopelecehanseksualiniakanruntuhjuga.SetidaknyabegitulahdoapacarBrigadirJ,VeraSimanjuntak,demikiandikutipdariDisway.MantanKadivPropamPolriIrjenFerdySamboditahandiMakoBrimob.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-KolumniskondangDahlanIskanmenyorotipelanggaranetikmantanKadivPropamPolriIrjenFerdySambodikasuspembunuhanYosuaHutabarataliasBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});IrjenFerdySambodianggapmelanggarprosedurdalampenanganantempatkejadianperkara(TKP)tewasnyaBrigadirJ,yaitudirumahdinasjenderalbintangduaitu.DalamtulisanDiswayberjudulMendungUdan,DahlanmenulismomentumklimakskelihatansudahdekatdenganditahannyasuamiPutriCandrawathiitu.BacaJuga:DiancamAkanDihabisi,ARTBakalBertanyaLangsungkepadaKapolriYangsempatbikinbingungadalahsangkaannya:hanyamelanggarkodeetik.Bukanpidana.Bukankejahatan.Bukanpembunuhan,dikutipdariDiswayedisiSenin(8/8).TulisanitubertepatandengansebulankematianBrigadirJyangtewasdirumahdinasSambo,DurenTiga,JakartaSelatanpadaJumat(8/7)lalu.Dahlanmenilaikebingunganpublikberalasan.Sebab,sanksipelanggaranetikhanyasoalstatuskeanggotaan.BacaJuga:BrigadirRickyRizalDitahan,IstriFerdySamboUngkapCintaTulusdiPinggirJalanKalaupelanggaranetiknyasangatberat,keanggotaannyabakaldicabutsecarapermanenaliasdipecat.Dipecat,sepertidrTerawandalamhalVaksinNusantara.DiadipecatdarikeanggotaanIkatanDokterIndonesia(IDI),lanjuttulisanDahlan.

NoraAlexandramemamerkanfotomesrabersamasuaminya,Jerinxyangbarusajabebasdaripenjara.Foto:Instagram/ncdpapljpnn.com,JAKARTA-MusikusJerinxSIDmerasagagalmenjadisuamidansempatdepresi,karenaduakalimasukpenjaradisaatusiapernikahannyadenganNoraAlexandra,masihseumurjagung.Jerinxbersyukur,sangistritakmeninggalkannyameskibanyaktekananyangditerimaNora.Sebab,banyakfansJerinxyangmenyebutnyasebagaipembawasialbagipentolanSIDitu.Priabertatoitumenyebuttidakadapernikahanyangsempurna.Jikapunada,hanyadifilm-filmfiksi.BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBeginiPernikahanadalahperihalpenyatuan2egoagarbertemudisatugariskeselarasanyangharmonis.Terdengarsimpeltapiaslinyaruwetmintaampunkarenasejatinyaisikepalamanusiatidakadayangbenar-benar100%sama.Sebuahpernikahanakandiujiketikaiasedangmengalamimasalahdancobaan,tulisJerinxlewatakunInstagram,Sabtu(6/8).Selainitu,perbedaanusiadirinyadenganNorayangterpauthingga18tahun,takbanyakmembantusaatmerekaditerjangmasalah.Pernikahankamicobaannyasungguhnyata.Darisebelumdansesudahmenikahsudahditerjangmasalahdemimasalahyangcukupserius.Jarakusiayang18tahunjugatidakbanyakmembantuketikatertimpamasalah.Kamiberduaadalahapi.Sayaterlalulamaterlibatdiduniaaktivismeyangcenderungtoxicdankeras.Istrijugasejaklahirtumbuhdilingkunganyangkeras.Jadinyayasama-samakeras,tuturnya.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaSaatberadadisituasiyangserbatertekan,JerinxmengakuiNoraAlexandrasungguhkuatdansetialuarbiasa.SebabbarusepuluhbulandipenjarakarenakasusIDI,JerinxkembalimasukbuikarenakasusdenganAdamDeni.KabareskrimPolriKomjenAgusAndriantoFoto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KabareskrimPolriKomjenAgusAndriantomenyebutakanadatersangkabarudalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});TersangkabaruiniakandiumumkanlangsungolehKapolriJenderalListyoSigitPrabowobersamatimkhusus(timsus).TunggupengumumanPakKapolridantimkhususbesok(Selasa),katadiaketikadikonfirmasi,Senin(8/8).BacaJuga:GegaraBrigadirRicky,KomnasHAMTakLangsungPercayadenganKeteranganAjudanFerdySamboNamun,salahsatuanggotatimsusitubelummaumemerincisoalsiapatersangkabaruyangakandiumumkantersebut.DiahanyameyakinikasuskematianBrigadirJdirumahdinasIrjenFerdySamboituakansegeratuntas.Insyaallahtuntas,katamantanKapoldaSumateraUtaraitu.BacaJuga:SoalPenembakandiRumahFerdySambo,Teddy:PembantuPresidenIkutanLatahJadiHakimDalamkasusiniPolritelahmenetapkanduaorangtersangka,yakniBhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEdengansangkaanPasal338KUHPjunctoPasal55danPasal56KUHP.TersangkakeduaadalahBrigadirRickyRizalatauBrigadirRR,disangkadenganPasap340KUHP(pembunuhanberencana)junctoPasal338junctoPasal55danPasap56KUHP.

PetugasSatreskrimPolrestaBanyumasmemeriksaseorangpriaberinisialTT(51)yangditangkapkarenamenjualistrinyauntukmelayaninafsusejumlahprialain.ANTARA/HO-PolrestaBanyumasjpnn.com,PURWOKERTO-TT(51)ditangkapSatuanReserseKriminalPolrestaBanyumas,PoldaJawaTengah.Diadidugamenjualistrinyamelayaninafsusejumlahpria.WargaKabupatenBanyumas,Jateng,ituditangkapdiYogyakarta1Agustus2022.BacaJuga:SuamidiSurabayaJualIstrikePriaHidungBelang,MotifnyaTernyataKasusiniterungkapsetelahistripelaku,I(35),melaporkanperbuatansuaminyakepadakamipadaMei2022,kataKepalaSatreskrimPolrestaBanyumasKompolAgusSupriadiSiswantodiKantorSatreskrim,Purwokerto,KabupatenBanyumas,Senin(8/8)siang.Diamengatakansetelahmenerimalaporanitu,pihaknyamelakukanpenyelidikandanmencarikeberadaanpelakuyangkabursetelahmengetahuiistrinyamelaporkanperbuatannyakepadapolisi.KompolAgusmenegaskanpelakuditangkappetugasSatreskrimPolrestaBanyumasdiYogyakartapada1Agustus2022.BacaJuga:DihajarSuami,NelliMengadukeRumahPakRTLaluMeninggal,IniPelakunyaMenurutdia,sejauhiniadatigapriayangdilayaniolehkorbanatasperintahdandibawahancamandaripelaku.Tigapriamerupakanorangdekatataurekandarisuamikorban.Penjara(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Utang-piutangdiperbolehkandalamIslamkarenatermasukakadtaawun(tolongmenolong),untukyangmembutuhkanbantuandanjugamerupakanakadtabarru(sosial),sebagaikepedulianmembantuorang-orangyangsedangdalamkesulitan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Lalubagaimanadenganhartahasilkorupsi,masihkahharusdikembalikankenegara,sementarapelakunyasudahdipenjara?Parapelakuusahayangmengakutelahmengalamipailit,tidaklahgugurbegitusaja.SecarahukumIslam,utangpadadasarnyamerupakanbagiandariamanahyangtetapwajibdikembalikankepadapihakkrediturketikatelahjatuhtempo.BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBeginiNabiMuhammadSAWbersabdamenunda-nundapelunasanutangolehseorangyangmampumelunasinyamerupakanbentukkezaliman(mathlual-ghaniyyidhulmun).Istilahlaindarikezalimaniniadalahmoralhazard.DalamtuntunanagamaIslam,seorangkreditur(pemilikpiutang)ketikamenghadapikasusadanyapihakdebitur(pemilikutang)dianjurkanagarmemberirelaksasihinggaseseorangmenjadimampu(QSAl-Baqarah[2]:182).BacaJuga:Jerinx:Benar,SayaSempatDepresi,MerasaGagaljadiSuamiNamun,ketikamenghadapiadanyakasusmoralhazardberupaupayauntukmengulur-ulurwaktusehinggamerugikankrediturataunegara,makapihakpemerintahberwenangmelakukantadib(pendidikanmoral)terhadapmereka.Adabeberapacaramemberikantadibterhadapdebituratauobligoryangnakalsemacaini,antaralaindenganjalandipenjara(habsun),diambilhartanyasecarapaksa(disita)(bial-qahri),ataubahkandenganjalanditahanpenyaluranhartanya(hajr).

KuasahukumBharadaE,DeolipaYumaramenjawabdiplomatissaatdisinggungperihalatasankliennyamemerintahkanuntukmenembakBrigadirJ.JawabanitudisampaikannyadiBareskrimPolri,Senin(8/8).Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-BhayangkaraDuaRichardEliezeraliasBharadaEmengakumenembakBrigadirNofryansahYosuaHutabarataliasBrigadirJatasperintahatasannya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});InsidenyangmenewaskanBrigadirYosuaituterjadidirumahdinasIrjenFerdySambo,KomplekDurenTiga,JakartaSelatanpadaJumat(8/7).Lantas,siapasosokatasanBharadaEyangmemerintahkanuntukmenembakaBrigadirJitu?BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraKuasahukumBharadaE,DeolipaYumaramenjawabdiplomatissaatdisinggungperihalatasankliennyaitu.Deolipamengatakanhaltersebutmerupakankewenanganpenyidik.Itusudahmasukkesubstansimateriil,sudahbukankewenangansayamenjawab,tetapikewenangandaripenegakhukumyanglainyaitukepolisian,kataDeolipadiBareskrimPolri,Senin(8/8)malam.BacaJuga:KeteranganBharadaEBerubahTotal,DuluMengakuEksekutor,Sekarang?Disisilain,DeolipaengganmengungkappengakuankliennyalebihdetailkarenaitusubstansimaterillperkarakasuskematianBrigadirJ.Salahsatukewenangandalampenyidikanyangsifatnyamateriiladalahkewenangandaripadapenyidikpolisi.Kalauformilkamibisa,ujarDeolipa.KetuaKomnasHAMAhmadTaufanDamanik.AristoSetiawan/jpnnjpnn.com,JAKARTAPUSAT-KetuaKomisiNasionalHakAsasiManusia(HAM)AhmadTaufanDamanikmengakutidakmudahpercayadenganketeranganaidedecamp(ajudandanasistenrumahtangga)mantanKadivPropamIrjenFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MenurutTaufan,merekabisasajaberbohongsoalkejadianyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratpada8Juli2022lalu.Apakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ucapTaufandiKomnasHAM,JakartaPusat,Senin(8/8).BacaJuga:SoalPenembakandiRumahFerdySambo,Teddy:PembantuPresidenIkutanLatahJadiHakimPria57tahunitupunmendesakkamerapengawasatauCCTVditempatkejadianperkarauntuksegeradibukakarenamenjadialatbuktiutama.MakanyasayadesakCCTVharusdibuka,alatkomunikasidibuka,karenakalaucumaketeranganorangdemiorang(tidakkuat),jelasnya.KetidakpercayaanTaufansemakindiperkuatlantaranBrigadirRickyRizalditetapkansebagaitersangka.HalinimembuktikanbahwaketeranganRickysaatdiperiksaKomnasHAMtidakbenar.BacaJuga:KeteranganBharadaEBerubahTotal,DuluMengakuEksekutor,Sekarang?Saatdiperiksa,RickymengakudirinyabersembunyidibalikkulkassaatperistiwapenembakanBrigadirJterjadi.Namunolehpolisi,Rickyjustruditetapkansebagaitersangkadengansangkaanterlibatpembunuhanberencana.

TimkuasahukumBhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEmenyambangiBareskrimPolri,Senin(8/8)malam.IlustrasiFoto/dok:Ricardo/JPNN.comjpnn.com,JAKARTA-TimkuasahukumBhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEmenyambangiBareskrimPolri,Senin(8/8)malam.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KedatanganduapengacaraBharadaE,yakniDeolipaYumaradanMuhammadBurhanuddindalamrangkaberkoordinasidenganpenyidikmengenaikasuspembunuhanBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.PengacaraeksajudanIrjenFerdySamboitumendadaktibadiBareskrimPolripukul20.46WIB.Sebelumnya,merekamenjadwalkankunjungankeBareskrimpadaSelasa(9/8)besok.BacaJuga:BharadaEJadiTersangkadanDitahan,BagaimanaKondisiKeluarga?Kedatangankamitentunyakepentingan-kepentinganuntukmenanganiperkara-perkara,salahsatumenanganiperkaraialahdengancaraberkoordinasi,kataDeolipadiBareskrimPolri.DeolipamengakubanyakhalyangingindikoordinasikandenganpenyidikPolri.Salahsatunya,lanjutdia,terkaitjusticecollaborator(JC)BharadaEyangsudahdiajukankepadaLembagaPerlindunganSaksidanKorban(LPSK)pagitadi.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraSelainitu,lanjutdia,pertemuanmalaminidimungkinkanuntukmenambahBeritaAcaraPemeriksaan(BAP)yangsudahdisampaikanBharadaE.Namun,diamemastikantidakadapernyataankliennyayangberubahhariini.SkuadPSMMakassardalamsebuahlagadiLiga12022/23.Foto:LigaIndonesiaBaru.jpnn.com,MAKASSAR-PSMMakassarakanmenjamuKedahFCpadasemifinalAFCCup2022zonaASEAN.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});PertandinganiniakanberlangsungdiStadionKaptenIWayanDipta,GianyarBali,Selasa(9/8/2022).DuelPSMvsKedahFCdiprediksibakalketatsangsengit.Sebab,keduatimsama-samaberambisimerebutkemenanganagarloloskebabakberikutnya.BacaJuga:PelatihKedahFCTebarAncamankePSMMakassar,Sorot1PemainDalamlagaini,PSMmaupunKedahFCbakalmenurunkanskuadterbaiknya.Kamiakanbekerjaekstrakerasuntukmeraihkemenangan,kataPelatihPSMMakassar,BernardoTavares,Senin(8/8/2022)siang.TimtertuadiIndonesiaitukemungkinanmenurunkanEvertonNascimento,YakobSayuri,danRezkiEkadilinidepan.BacaJuga:SambutHUTke-77RI,PelatihPSMMakassarPunyaPesanPentinguntukSuporterKemudian,PSMbakalmengandalkanWiljanPluim,RasyidBakri,sertaArfanditengah.Sementaraitu,YuranFernandes,ErwinGutawa,YanceSayuri,danAgungMannanakanmenjagabentengpertahananPasukanRamang.Terakhir,RezaAryaPratamabakalmenjadipemainterakhirdibawahmistar.PetugaspemadamkebakaranberjibakumemadamkanapiyangmembakarMazdaCX7.Foto:CuciHati/jpnn.comjpnn.com,ILIRBARAT-MobilSUVMazdaCX7nomorpolisiD1584IYwarnaputihterbakardiJalanHuluBalang,KelurahanDemangLebarDaun,KecamatanIlirBaratI,Palembang,Senin(8/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1600966010670-0);});PemilikmobilOscarFauzi(42),wargaJalanBankRayaII,KelurahanDemangLebarDaunmengungkapkankronologikejadianbermulasekitarpukul14.30WIBseusaimengisibahanbakarminyak(BBM)PertamaxdiSPBUJalanHuluBalang.SetelahmengisiBBMterdengarsuaraletusandaribandepankananmobil,kemudianmunculapi.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanOscarbersamaistridanketigaanaknyalangsungkeluardarimobiluntukmenyelamatkandiri.Jadi,awalmulaituadasuaraletusandaribandepankanan,kemudianapitiba-tibamuncul,sayabersamaistridanketigaanakkeluar,mobilpunmeledakdanterbakar,ungkapdia.Oscarmengakusebelumkejadiantidakadakejanggalandimobil.BacaJuga:SiswaSMPTewasDitusukdiSekolah,PelakunyaTakAdayangMenyangkaWaktuperjalanandarirumahtidakadatanda-tandakejanggalanapa-apa.Mobilinijugasebenarnyajarangdipakai,karenahabisbensinmakanyamaudiisi,jelasnya.SatuunitmobilPemadamKebakaran(Damkar)PemkotPalembangdidatangkanuntukmemadamkanapi.TunggalputriIndia,PusarlaV.Sindhu..Foto:BadmintonPhoto-BWFjpnn.com,BIRMINGHAM-IndiamemborongtigamedaliemasdariajangCommonwealthGames2022yangdihelatdiBirmingham,Inggris.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});TigawakilIndiayangsuksesnaikpodiumtertinggiantaralainLakshyaSen(tunggalputra),PusarlaV.Sindhu(tunggalputri),sertaChiragShetty/SatwiksairajRankireddy(gandaputra).LakshyaSenmerebutemasseusaimengalahkantunggaputraMalaysia,NgTzeYong.BacaJuga:AFCCup2022:PrediksiSusunanPemainPSMMakassarvsKedahFCPemainranking10duniaitumengalahkanTzeYonglewatpertarungantigagimdenganskor19-21,21-19,21-16.KemenanganSendiikutiolehrunnerupOlimpiadeRio2016,PusarlaV.Sindhu.KampiunSingaporeOpen2022itumenangdenganskor21-15,21-13atasMichelleLi(Kanada).SatulagiwakilIndiayangberjayadiCommonwealthGames2022ialahChiragShetty/SatwiksairajRankireddy.BacaJuga:CommonwealthGames2022:NgTzeYongMenggila,LeeChongWeiBeriPetuahPentingJawaraIndiaOpen2022itumengatasiperlawananwakiltuanrumahBenLane/SeanVendyduagimlangsung,21-15,21-13.Dengankemenanganini,Indiatercatatmembawapulangtigamedaliemasdarisektorperorangancaborbulutangkis.

HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).FotoIlustrasi:Ricardo/JPNN.comjpnn.com,JAKARTA-HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});InvestasisafeheavenberbalikmenguatdaripenurunanakhirpekanlaludanbertenggerdiataslevelpsikologisUSD1.800perounce.PenguatanhargaemasditopangolehgreenbackyanglebihlemahmenjelanglaporaninflasiutamaAmerikaSerikat.BacaJuga:HargaEmasPegadaian,Sabtu6Agustus2022,AntamdanUBSKompakNaikKontrakemaspalingaktifuntukpengirimanDesemberdidivisiComexNewYorkExchange,terdongkrakUSD14atau0,78persen,menjadiditutuppadaUSD1.805,20perounce.EmasberjangkaanjlokUSD15,7atau0,87persenmenjadiUSD1.791,20padaJumat(5/8),setelahmelonjakUSD30,5atau1,72persenmenjadiUSD1.806,90padaKamis(4/8).IndeksUSDyangmengukurgreenbackterhadapenammatauangutamalainnya,turun0,17persenmenjadi106,4360,karenainvestormenunggudatainflasiASyangakandirilispadaRabu(10/8),membuatemaslebihmurahbagipemegangmatauanglainnya.BacaJuga:HargaEmasHariIniMerosotTajam,AmbyarEmasjugamenemukandukungantambahandariimbalhasilobligasipemerintahASyangturundanpembalikankeuntunganawalpadasaham-sahamAS.JikaWallStreetdanaset-asetberisikotetapdalamtrenpasarbearish,makakitaharusmengabaikansinyalinidenganrisikokitasendiri,kataanalisekuitasStoneX,FawadRazaqzadadalamkomentarnyapadaSenin(8/8).PengacaraBharadaE,DeolipaYumaradanMuhammadBurhanuddindikantorLPSK,JakartaTimur,Senin(8/8).jpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangSenin(8/8)tentangBharadaEmengakusudahlegakarenamembongkarkasusBrigadirJ,sementaraituDahlanIskanmenuliskanrahasiabesarsoalkasusBrigadirJ,hinggaselainpelecehanseksualDahlanjugamenuliskansoalurusancintaPutriCandrawathi.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarBacaJuga:5BeritaTerpopuler:BharadaESudahBicara,CampurTanganFerdySamboTerungkap,MasihAdaKejutanLainKolumniskondangDahlanIskanpunpenasarandenganmotifdibalikkasuspembunuhanYosuaHutabarataliasBrigadirJdirumahmantanKadivPropamPolriIrjenFerdySambo.MelaluitulisanberjudulMendungUdandikolomDisway,DahlanmulanyamenyinggungtentangskenariopelecehanseksualhinggasoalhubungancintaBrigadirJdengansangkekasihVeraSimanjuntak.DiapunmempertanyakanapakahistriFerdySambo,PutriCandrawathiakankonsistendenganskenariodilecehkansecaraseksual.BacaJuga:5BeritaTerpopuler:IrjenFadilImranBicaradenganPresiden,PasukanBrimobBergerak,AdaTumbalpadaKasusBrigadirJ?Bacaselengkapnya,kliklinkdibawah:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesar

RezaIndragiri.IlustrasiFoto:AndikaKurniawan/JPNN.comjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielmenilaipemunculanistriIrjenFerdySambo,PutriCandrawathidiMakoBrimob,KelapaDua,Depok,Minggu(7/8)sebagaiproblematik.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalituterkaitbenartidaknyaterjadikejahatanseksualolehBrigadirJterhadapPutriCandrawathidirumahdinasmantanKadivPropamPolri,DurenTiga,JakartaSelatanpadaJumat(8/7)lalu.PutriCandrawathi(kanan)didepanMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianBacaJuga:DahlanIskanSinggungSkenarioPelecehanSeksualPutriCandrawathidanUrusanCintaRezamengatakandariseluruhkorbankecelakaanlalulintas,15persenmengalamiguncanganjiwa.Sementaraitu,dalamkasuskejahatanseksual,korbanyangterguncangberatmencapai80persen.Satudatainisajasudahmenunjukkankeseriusankejahatanseksual.Korbansudahsepatutnyaditolong.Hak-haknyadipenuhi,ucapRezakepadaJPNN.com,Senin(8/8).BacaJuga:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarAkantetapi,lanjutReza,apakahdalamkasusDurenTigabenar-benaradakejahatanseksual?Tentuperlumenungguhasilinvestigasikepolisian.Namun,RezamelihatadayangproblematikdaripemunculanistriFerdySambodidepanmediaketikamendatangiMakoBrimob.TerlebihPutridisebut-sebuttelahmengalamipelecehanseksual.PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-SuratIzinMengemudi(SIM)memilikimasaberlakuselama5tahunsetelahdibuat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});UntukandayangberdomisilidiJakartadaninginmemperpanjangdokumentersebut,DirektoratLaluLintasPoldaMetroJayamenyediakanlayananSIMKeliling.Dilansirdariakunresmi@TMCPoldaMetrodiInstagram,pihakPMJmenyiapkan5gerailayananSIMyangtersebardi4wilayahkotaDKIJakarta,Selasa(9/7).BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaPusatbisamemperpanjangSIMdiKantorPosLapanganBanteng.Kemudian,wargayangtinggaldiwilayahJakartaBaratpelayananSIMkelilingdibukadiLTCGlodokdanMallCitraland.BagiyangberdomisilidiJakartaSelatanbisamengaksesSIMkelilingdiKampusTrilogiKalibata.BacaJuga:LokasiLayananSIMKelilingdiJakartaHariIni,Ada5GeraiTerakhir,wargaJakartaTimurbisamenujukeGrandMallCakung.LayananSIMKelilinginiberoperasimulaipukul08.00hinggapukul14.00WIB.

SejumlahajudandanpengurusrumahtanggaIrjenFerdySambosaatmenjalanipemeriksaandiKantorKomnasHAM,Jakarta,Senin(1/8).Foto:Ricardo/JPNNjpnn.com,JAKARTAPUSAT-BrigadirRickyRizalatauRRsudahditetapkansebagaitersangkadalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Denganadanyapenetapantersangkaini,terungkapdiasudahberbohongdalamkesaksiannyapadaKomnasHAMbeberapawaktulalu.Dalamketerangannya,BrigadirRickymengakutahuadabakutembakantaraBharadaEdanBrigadirJ.Namun,BrigadirRickyhanyabersembunyidibalikkulkas.BacaJuga:HariIniKapolriUmumkanTersangkaBaruKasusBrigadirJ,KomjenAgus:InsyaallahTuntasHalinijugasudahdiungkapkanolehKetuaKomnasHAMAhmadTaufanDamanik.RickymengatakandiabersembunyidibalikkulkaskanRickyyangbilang,bukansaya,sayakatakanayodiuji.SekarangpenyidikmenjadikandiatersangkaPasal340KUHP,pembunuhanberencanaitu,ujarTaufankatadiakepadawartawandiJakartaPusat,Senin(8/8).MenurutTaufan,kebohonganitumembuatmerekamenjaditidakmudahpercayadenganketeranganparaajudanIrjenFerdySambo.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraApakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ujarpriaberusia57tahunBareskrimPolrimenetapkanBrigadirRickyRizalsebagaitersangkadalampembunuhanBrigadirJ.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-TimKhususPolritelahmenetapkanBrigadirRRatauRickyRizal,ajudanPutriCandrawathi,istriIrjenFerdySambo,sebagaitersangkadalamkasusdugaanpembunuhanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutkanalasanBrigadirRRsebagaitersangkakasuspolisitembakpolisiitu.Alasannya,duaalatbuktisudahcukupuntukmenetapkanstatusnyasebagaitersangka,kataBrigjenAndisaatdikonfirmasidiJakarta,Senin(8/8).BacaJuga:MabesPolriBanjirKaranganBunga,MasyarakatMintaKasusBrigadirJSegeraDituntaskanHanyasaja,Anditidakmemerinciduaalatbuktitersebutapasaja,danbagaimanaperanBrigadirRRdalamperistiwapenembakanyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratdirumahdinasKadivPropamPolridiKomplekPolriDurenTiga,JakartaSelatanpadaJumat(8/7).Itumateripenyidikan,bukanuntukpublikasi,ujarketuaTimPenyidikanTimKhususBareskrimPolriitu.Sebelumnya,penyidikBareskrimPolritelahmenahansopirdanajudanPutriCandrawathi,istriIrjenFerdySambo,berisinialBharadaREdanBrigadirRR.BharadaREadalahBharadaRichardEliezerPudihangLumiuatauBharadaEyangsudahditetapkansebagaitersangkadandilakukanpenahananpadaRabu(3/8).SedangkanBrigadirRRditahanmulaiMinggu(7/8)diRumahTahanan(Rutan)BareskrimPolri.BacaJuga:BrigadirRickyMengakuCumaMenyaksikanSebagianPeristiwa,KiniJadiTersangkaPembunuhanBerencanaBrigadirRRditersangkakandenganPasal340KUHPjunctoPasal338junctoPasal55danPasal56KUHP.PasaliniberbedadengansangkaanpasalterhadapBharadaE,yakniPasal338junctoPasal55danPasal56KUHP.

Priamengalamimasalahejakulasidini(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Ejakulasidinimerupakanproseskeluarnyaspermayangterjadilebihcepatdariyangdiharapkansaatberhubunganseksual.Priadianggapmengalamiejakulasidinibilasetelahsatumenitpenetrasi,tidakbisamenundaejakulasisaatberhubunganseksual,danmerasafrustrasiatautertekansehinggarelatifmenghindarikeintimanseksual.Janganabaikankondisiejakulasidini,karenabisamengganggukelancaranhubunganintim.Sebagailangkahawal,cobalakukancaramengatasiejakulasidinisendiriberikutini:BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBegini1.KomunikasikandenganPasanganSaatadamasalahejakulasidini,pasanganbisaterkenadampak.Tidakjarangiamenjadibingung,kesal,tidakpuas,dansebagainya.Komunikasikanlahmasalahejakulasidinidenganpasangan.Denganbegitu,masalahinidiharapkandapatbisasegerateratasidankeintimantetapterjaga.Seringkali,salahsatupenyebabejakulasidiniadalahmasalahdenganpasangan.Jikamasalahdapatdiselesaikan,diharapkanperformaseksualpunmembaik.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinya2.LakukanMasturbasiKemudian,caramengatasiejakulasidinisendiridirumahsecaraalamiadalahmasturbasi.Cobamasturbasi1-2jamsebelumberhubunganseksualdenganpasangan.3.LatihanSenamKegelAgartidakcepatkeluarsaatberhubungan,lakukansenamKegelsebagaicarauntukmengatasinya.PengacaraHotmanParismenyebutmasadepanBharadaEditentukansekarang.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismenyinggungsoalmasadepanBharadaE,tersangkatewasnyaBrigadirJ.HaltersebutberkaitandenganstatusBharadaEsebagaisaksikuncidalamkasuskematianBrigadirJ.MenurutHotmanParis,keterangandanpengakuandariBharadaEsangatlahpentingdalammengungkapkasusitu.BacaJuga:SiapaTersangkaBaruKasusBrigadirJ?HotmanParis:MungkinIrjenatauBrigjenPolisiMasadepanmuditentukansekaranginikarenakalaukamubuatpengakuansejujurnyamakapenyidikakanterbantuuntukmengungkapkanfaktasebenarnya,ujarHotmanmelaluiakunnyadiInstagramdikutippadaSelasa(9/8).PengacarabergayaparlenteitumengingatkanbebanyangharusditanggungBharadaEjikatakmengungkapkasussecarakeseluruhan.Lagi-lagi,rivalRazmanNasutionitumenyinggungsoalmasadepan.BacaJuga:HotmanParis:BharadaE,SayaPunyaIndraKeenam,Segeralah...Ingat,kalaubebannyahanyadikamu,bayangkanberatnyahukumandanmasadepanmumasihpanjangadikku,ucapHotmanParis.Olehkarenaitu,diamengimbauagarBharadaEbisamembuatpengakuanjujurdanmengungkapaktor-aktordibalikkasuskematianBrigadirJ.RumahpribadiFerdySamboyangtertutuprapatsaatPutriCandrawathimenjalanipemeriksaanolehLembagaPerlindunganSaksidanKorban(LPSK)diJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa(9/8).Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-IstriIrjenFerdySambo,PutriCandrawathimenjalaniassessmentpsikologisolehLembagaPerlindunganSaksidanKorban(LPSK),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaandilakukandikediamanpribadiIrjenFerdySamboyangberadadiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.DaripantauanJPNN.com,timLPSKtibadirumahpribadiFerdySambosekitarpukul10.20WIBmenaikimobilToyotaFortuner.BacaJuga:HotmanParis:Halo,BharadaE,KamuBisaSajaMerasaNyamandiTingkatPenyidikan,tetapiSekitar4orangdaritimLPSKlangsungmemasukirumahpribadiFerdySambo.RumahFerdySambosendiridikawalketatolehbeberapaorangyangmengenakanpakaiansipil.Sudahya,enggakenakdenganwarga(sekitar).Sayalelahmenjaga,menguruskaliansemua,katasalahsatuorangdenganpakaianpremankepadaawakmedia.BacaJuga:5PengakuanTerbaruBharadaE,ArahnyaSudahJelas,HariIniJenderalSigitUmumkanAktorPentingAwakmediayangberadadidepanrumahFerdySambotidakdiperbolehkanuntukmenunggudidepanrumahberlantai3itu.LPSKakanmemintaketeranganPutriCandrawathi,istrimantanKadivProvamPolriIrjenFerdySambo.KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.

TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.

IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.

MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.Marshanda.FotodokJPNN.comjpnn.com,JAKARTA-AktrisMarshandamengungkapfaktaterkaitkabardirinyayangdisebuthilangdiLosAngeles,Amerikaolehsahabatnya,SheilaSalsabila.Faktanya,ibusatuanakinimalahdimasukkankeRumahSakitJiwa(RSJ)danmendapatkanperlakukanyangtaksemestinya.KedatangannyakeLAsaatMarshandametimemaindidaerahpantai,VeniceBeachmalahmenjadibencanakarenadianggaphilang.BacaJuga:Jerinx:KalauEnggakKuatMental,Lama-lamaBisaGilaSaatitu,Sheilamenelepondirinyasebanyaktujuhkali.Sheilayangjugamemilikibipolar,mengalamipanickattackkarenatidakbisamenemukanMarshandadanlangsungmenghubungi911.Guetinggalinhpgue,karenagueenggakmauorangtahuguedimana,guemaumetime,ujarMarshandalewatchanelYouTubemiliknya.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiLalu,ambulansmendadakmenjemputnyadijalan.Guebingungkenapa(ambulans)jemputgue,yangpadaujung-ujungnya(guediantarke)rumahsakitjiwa,mentalhealth,sambungnya.

Tags

Artikel Terkait

qq slot win

昭通市

qq slot win

OVVQWhA

2022-08-14 05:41
1302 min read
pemain slot terbaik

台湾省

pemain slot terbaik

j1usIH0

2022-08-14 04:37
106 min read
best slots on mecca bingo

龙岩市

best slots on mecca bingo

ikGDuVl

2022-08-14 03:18
2289 min read

Terpopuler Bulan Ini

01

togel mainan

海北藏族自治州

2022-08-14 05:32
1108 min read
02

akun pulsa 303

吉林市

2022-08-14 05:23
1519 min read
03

main togel onlain

江北区

2022-08-14 05:14
2834 min read
04

70freespins

潍坊市

2022-08-14 04:29
1364 min read
05

wap togel178

张家界市

2022-08-14 03:31
2400 min read